Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04101.1.g00020.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LFY
Protein Properties Length: 313aa    MW: 33589 Da    PI: 6.7299
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                       FLO_LFY   1 mdpea.fsas.lfkwd...praaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvs 76 
                                   mdp++ fsa+  f+wd   p   a+a+p+   +    ++++l    a  a++ releel+ +yGvr +tva+i elGft+s   1 MDPNDaFSAAhPFRWDlgpP---AHAAPHPPPPPPPPPPPSLPFPLAPPANAPRELEELVAGYGVRPSTVARILELGFTAS 78 
                                   777654876659****6632...333333333333333344456677788889**************************** PP

                       FLO_LFY  77 tLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqee 157
                                   tL++m+++eldd+m++l+ +fr+d+l+Ger+G++aa+raer r+ +      r      ++  +lda+sqe+ls+e++  79 TLLGMTERELDDMMAALAGLFRWDVLLGERFGLRAALRAERARVVALG---GRF-----QTGGTLDAASQEVLSDERDVA- 150
                                   ********************************************9955...444.....46779***********98855. PP

                       FLO_LFY 158 keaagsggeglgeaelvaaeekkseeekkkaskk.kqkrkkkkelkse.......ededeeeeededeegsgedgeerqre 230
                                       +sgg    e +   a+ +k+ +++  ++k  k++rkk+ +           e ++++   ++++e+s+ +g erqre 151 ----ASGGVADDEIGRRLAAGRKQAKKEAATRKGkKARRKKELRP--LdvlevenEGDEDDGGASDSTESSAGGGGERQRE 225
                                   ....44444444444433333222222222222212222222221..12334443334444444555556677788***** PP

                       FLO_LFY 231 hPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtk 280
                                   hPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq+iak  G+k+Ptk 226 HPFVVTEPGEVARAKKNGLDYLFHLYEQCRIFLLQVQTIAKMGGHKSPTK 275
                                   *************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.2E-1021275IPR002910Floricaula/leafy protein
SuperFamilySSF1014477.59E-62737No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A2e-26219275258PROTEIN LEAFY
2vy2_A2e-26219275258PROTEIN LEAFY
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976675.11e-129PREDICTED: probable transcription factor FL
SwissprotQ0JAI11e-115FL_ORYSJ; Probable transcription factor FL
TrEMBLK3YC121e-129K3YC12_SETIT; Uncharacterized protein
STRINGSi011756m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number